IP Address: 204.60.84.148
Country: United States (US)
Domain Age: 8
Created Date: 10-06-2007
Updated Date: 29-01-2015
Expired Date: 10-02-2018
Meta Title: Holyoke Credit Union | Holyoke, West Springfield, Agawam MA
Meta Description: Holyoke Credit Union, with MA locations in Agawam, Holyoke and West Springfield, offers a range of personal and business banking services.
Meta Keywords: massachusetts credit union, holyoke federal credit union, holyoke credit union holyoke ma, credit unions in ma, credit union in holyoke, credit union west springfield, western MA credit union, credit union agawam
GaID: 67875

Server location


Geo IP provides you such as latitude, longitude and ISP (Internet Service Provider) etc. informations. Our GeoIP service has found where is host holyokecu.com . hosted in United States and accessing the internet through COCC .

Latitude: 42.2903
Longitude: -72.6404
Timezone: America/New_York
Country: United States (US)
City: Easthampton
Region: Massachusetts
Region Code: MA
Postal Code: 01027

DNS Records


DNS (Domain Name System) is a system that converts human-readable website names into computer-readable numeric IP addresses.

A record assigned to 204.60.84.148 for holyokecu.com

Host Type TTL Class Other
holyokecu.com. SOA 899 IN dns1.cocci.com. hostmaster.holyokecu.com. 201505140400 3600
holyokecu.com. NS 899 IN dns1.cocci.com.
holyokecu.com. NS 899 IN dns2.cocci.com.
holyokecu.com. A 899 IN 204.60.84.148
holyokecu.com. MX 899 IN 10 mail.cocci.com.
holyokecu.com. MX 899 IN 20 mail2.cocci.com.
holyokecu.com. MX 899 IN 30 mail3.cocci.com.
holyokecu.com. TXT 899 IN "v=spf1 mx include:spf.cocci.com -all"
holyokecu.com. SPF 899 IN "v=spf1 mx include:spf.cocci.com -all"

Heading Analysis


Holiday Rewards
New Rewards
Personal Loans
Get Paid to Switch
Advantage Loan
Love My CU
Holiday Hours
Fraud Alert
AutoSmart
Consumer Loan Center
Mortgage Center

Whois Information


In this section, you can reach when the website was registered, when it will be expire, what is contact details of the site with the following informations.

holyokecu.com has 8 years old. holyokecu.com registered by NETWORK SOLUTIONS, LLC.. holyokecu.com taken by PERFECT PRIVACY, LLC on 10/06/2007 and it will be expired on 10/02/2018

Registrar Name: NETWORK SOLUTIONS, LLC.
Registrar Organization: NETWORK SOLUTIONS, LLC.
Registrant Name: PERFECT PRIVACY, LLC
Created Date: 10/06/2007
Updated Date: 29/01/2015
Expires Date: 10/02/2018
Admin Name: PERFECT PRIVACY, LLC
Technical Name: PERFECT PRIVACY, LLC

HTTP Header Analysis


HTTP Header information is a part of HTTP protocol that a user's browser sends to called Microsoft-IIS/7.0 containing the details of what the browser wants and will accept back from the web server. Http Headers of Holyokecu.com

Status-Code: 200
Response Time: 521
Cache-Control no-cache
Pragma no-cache
Content-Type text/html; charset=utf-8
Expires -1
Server Microsoft-IIS/7.0
X-AspNet-Version 4.0.30319
X-Powered-By ASP.NET
Date Mon, 14 Dec 2015 05:38:04 GMT
Content-Length 82850
Go to top
More Less
More Less
More Less

Related pages


rental bkstr comwww wearevision comnbssxwww easternmetalsecurities comtrinitymidland orgnewcastle perm internetrbsdigimjusd jobsjaffnawin tamil newsblamanchm2inet icicibankwwqw.youtube.comwww myribbongift cawww.faturadio.comglfl edu lbnarutogames.comturbota.comwww.turbotax.commfdtc emailgpschools schoolwires netchase c0ombcx bearded collies3650nlinewayfrare3speedholsterysps.comwww.otmail6parkldjb bcepizzarama great fallspcbankinjcpportaitsl├Žknir.ispapajphtrainttimesthredleslearnbiz simulationsaaos netwww ffbtexas comhotschedules xomebay.co.u7kpalo cedro sda churchasdamoney.comwww.5ondemandcardexincecustomeswww.bidwhistonline.comwww academybankmw comsmythsnwww.ccrmls.rapmls.comadrologysavingsandloans.com.auwww marchantpm comboursuafnbamboy comwww.argoes.comwww.qwestdex.comadarolsvcancwww bconline gov bc caembisalvmpcaresperfectgirls.netywww keystonefireworks compedmeds.comwww eastccbank netlsi fiudexonlwww adonecu orgwww.ty.com hello kittywearthersawww youtubelive griheartradio copmdmacc.edu webmailwww iccuonline comfootloock