IP Address: 50.63.202.6
Country: United States (US)
Domain Age: 9
Created Date: 31-07-2007
Updated Date: 27-06-2015
Expired Date: 31-07-2016

Server location


Geo IP provides you such as latitude, longitude and ISP (Internet Service Provider) etc. informations. Our GeoIP service has found where is host missouriwarrants.org . hosted in United States and accessing the internet through .

Latitude: 33.6119
Longitude: -111.8906
Timezone: America/Phoenix
Country: United States (US)
City: Scottsdale
Region: Arizona
Region Code: AZ
Postal Code: 85260

DNS Records


DNS (Domain Name System) is a system that converts human-readable website names into computer-readable numeric IP addresses.

A record assigned to 50.63.202.6 for missouriwarrants.org

Host Type TTL Class Other
missouriwarrants.org. SOA 3599 IN ns51.domaincontrol.com. dns.jomax.net. 2010 7200 604800 3600
missouriwarrants.org. A 3599 IN 50.63.202.6
missouriwarrants.org. MX 3599 IN 0 smtp.secureserver.net.
missouriwarrants.org. MX 3599 IN 10 mailstore1.secureserver.net.
missouriwarrants.org. NS 3599 IN ns51.domaincontrol.com.
missouriwarrants.org. NS 3599 IN ns52.domaincontrol.com.

Whois Information


In this section, you can reach when the website was registered, when it will be expire, what is contact details of the site with the following informations.

missouriwarrants.org has 9 years old. missouriwarrants.org registered by GoDaddy.com, LLC. missouriwarrants.org taken by Kenneth Dickson on 31/07/2007 and it will be expired on 31/07/2016

Registrar Name: GoDaddy.com, LLC
Registrant Name: Kenneth Dickson
Created Date: 31/07/2007
Updated Date: 27/06/2015
Expires Date: 31/07/2016
Admin Name: Kenneth Dickson
Technical Name: Kenneth Dickson

HTTP Header Analysis


HTTP Header information is a part of HTTP protocol that a user's browser sends to called Microsoft-IIS/7.5 containing the details of what the browser wants and will accept back from the web server. Http Headers of Missouriwarrants.org

Status-Code: 200
Response Time: 1449
Cache-Control no-cache
Pragma no-cache
Content-Type text/html; charset=utf-8
Expires -1
Server Microsoft-IIS/7.5
X-AspNet-Version 4.0.30319
X-Powered-By ASP.NET
Date Mon, 15 Feb 2016 07:12:27 GMT
Content-Length 299
Age 1
Connection keep-alive
Go to top

Reverse Ip

Websites hosted with same IP Address

Favicon of universaldivineshop.com universaldivineshop.com Divine Shop
Favicon of htphotog.com htphotog.com Home - htphotog.com
Favicon of loansreduced.com loansreduced.com
Favicon of wcapps.directory wcapps.directory Managing Projects | Leasing GTLDs – Helping Our Clients Facilitate Com...
Favicon of speakquick.de speakquick.de englisch schnell lernen | sprachschule leipzig
Favicon of dabias.de dabias.de Home
Favicon of uebersetzungenmuenchen.de uebersetzungenmuenchen.de
Favicon of fotovox.de fotovox.de FotoVox | Rund ums Fotografieren
Favicon of chatterbox-sprachreisen.de chatterbox-sprachreisen.de Chatterbox Sprachreisen
Favicon of erbaviva.de erbaviva.de
More >>

Reverse Whois

Websites registered with same Owner.

Favicon of pennsylvaniawarrants.org pennsylvaniawarrants.org
Favicon of cash4court.net cash4court.net
Favicon of checkforwarrants.net checkforwarrants.net
Favicon of washingtonwarrants.org washingtonwarrants.org
Favicon of utahwarrants.org utahwarrants.org
Favicon of ohiowarrants.org ohiowarrants.org
Favicon of minnesotawarrants.org minnesotawarrants.org
Favicon of indianawarrants.org indianawarrants.org
Favicon of georgiawarrants.org georgiawarrants.org
Favicon of illinoiswarrants.org illinoiswarrants.org
More >>
More Less
More Less
More Less

Related pages


tubgegaloreelcabop.orgpffcu jobsloolacmtmobil.ecomgcsnc jobsfix iphone screen madison wiboulder canyon apartments west jordan utahwest pointe bankwww bolainez ministrieswww asdamoneyfnbstigler comepay howardc0ast to coast amwww lilianashoes combooksamiilionechrdsuiuonline comcnpmns mumcuny onlinewww nmemags comwww.walgreemwcsdic orgbinghamtonhelpwantedfdfcu.orgwww funasia net radiokijiji annapolb firstbankswww.merialrewardsprogram.commondak humane societyautocenter co ilent univ tlnresnet uciyoutubdmp3myaircanadawaynes cycle waynesboro vaolerebels comdolminoeswww yds mumbaiboonprixegon zehndebtonline.co.ukbhcc onecardtaboulrwww.siouxcityschools.orgwww.cleanerssupply.comhamblys peikelowna backpagecognizantbenefits comduncan motors knoxvilleminicrarfttillyysmywaketechcardmisspassagrillewww odenzareg comyahoonaulnifty.orhmisspassagrillehealthsherpmycpemonitorsakai.wellesley.edubblackandsonsconscienlyim.chikka.textwww fnbsd comgooglfldistoniancnnneewsatdhe.neetholiday lettings vilamourawww 21stcenturytips comcircnifomyaccessonegaytube.fomuiuonline commeckrod manatronspccard.camy siast sk ca