IP Address: 97.74.144.84
Country: United States (US)
Domain Age: 9
Alexarank: #8993846
Created Date: 26-10-2007
Updated Date: 26-11-2013
Expired Date: 26-10-2022
Meta Title: Home
Meta Description: Joomla! - the dynamic portal engine and content management system
Meta Keywords: joomla, Joomla

Server location


Geo IP provides you such as latitude, longitude and ISP (Internet Service Provider) etc. informations. Our GeoIP service has found where is host uaw1268.org . hosted in United States and accessing the internet through .

Latitude: 33.6119
Longitude: -111.8906
Timezone: America/Phoenix
Country: United States (US)
City: Scottsdale
Region: Arizona
Region Code: AZ
Postal Code: 85260

DNS Records


DNS (Domain Name System) is a system that converts human-readable website names into computer-readable numeric IP addresses.

A record assigned to 97.74.144.84 for uaw1268.org

Host Type TTL Class Other
uaw1268.org. SOA 3599 IN ns55.domaincontrol.com. dns.jomax.net. 2010 7200 604800 3600
uaw1268.org. A 3599 IN 97.74.144.84
uaw1268.org. MX 3599 IN 0 mail.uaw1268.org.
uaw1268.org. NS 3599 IN ns55.domaincontrol.com.
uaw1268.org. NS 3599 IN ns56.domaincontrol.com.

Heading Analysis


ACTION ALERT
Education Committee Scholarship
3rd Annual Black History Program
2016 Woman of the Year
Contact
Links
Be Heard
Quick History

Whois Information


In this section, you can reach when the website was registered, when it will be expire, what is contact details of the site with the following informations.

uaw1268.org has 9 years old. uaw1268.org registered by GoDaddy.com, LLC. uaw1268.org taken by Registration Private on 26/10/2007 and it will be expired on 26/10/2022

Registrar Name: GoDaddy.com, LLC
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Created Date: 26/10/2007
Updated Date: 26/11/2013
Expires Date: 26/10/2022
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Technical Name: Registration Private
Technical Organization: Domains By Proxy, LLC

HTTP Header Analysis


HTTP Header information is a part of HTTP protocol that a user's browser sends to called Apache containing the details of what the browser wants and will accept back from the web server. Http Headers of Uaw1268.org

Status-Code: 200
Response Time: 953
Date Thu, 25 Feb 2016 22:32:08 GMT
Server Apache
P3P CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM"
Cache-Control no-cache
Pragma no-cache
Set-Cookie 53f94ae28286625d467fde6c991deb78=05odm2q2hakuguubagd2obhs93; path=/
Keep-Alive timeout=15, max=100
Connection Keep-Alive
Transfer-Encoding chunked
Content-Type text/html; charset=utf-8
Go to top

Reverse Ip

Websites hosted with same IP Address

Favicon of adajaarsma.com adajaarsma.com Ada Jaarsma: Home
Favicon of pennnationalinn.com pennnationalinn.com default.secureserver.net
Favicon of brackencountysheriff.com brackencountysheriff.com
Favicon of wingspanpictures.com wingspanpictures.com Wingspan Pictures
Favicon of arthurplace.ca arthurplace.ca ArthurPlace.ca
Favicon of cowpots.com cowpots.com CowPots Bio pots are better for the environment, people and plants
Favicon of turkel.org.il turkel.org.il 'Turkel Tribe' Genealogy - Turkel Turkl Tirkel Terkel חקר משפחת טירקל
Favicon of soulsharbor.us soulsharbor.us Souls Harbor Demonstration Page;
Favicon of dorontal.net dorontal.net דורון אברהם טל (טירקל) - Doron A. Tal (Tirkel)
Favicon of amclandscaping.ca amclandscaping.ca AMC Landscaping Inc.
More >>

Similars

Favicon of uaw1268.com uaw1268.com Home
More Less
More Less
More Less

Related pages


aa routefinferhansons outfittersnjcpennysnkernewspsuone comwww pipefitterscu orgcvcs waterloo iowawww bpbbank comwww crestviewrv comwww megduerksen commyokanagan.bc.cawww fsblivingston comccoera orgwqlmarfootlockdraynairsidcks sporting goodsfrm model management reviewssnipm3www.clarksvillegw.comwww coastalwhc comsorptecmyaccessfcrissleyswergnerswww.alligentairlinessssfcusouthwest corvettes and classicssereslykhantv.vomdiesel trux and partsmyced netvogagepriveclersonicpharmaprixsondagewww breitlingcurrency blogspot compgusd powerschoolglobefund caamberapttraveloairvytauras kuzinkovaspassportlondon dfa iewww.njmvc.gobelephant auto group katy texaswww jp pima govupwey cricket clubjh churchill funeral home murray kynbaukriwww.amtrust.comtruvagacyberpressslofgmeinmy hervalife.comwww.cheatbook.dewww mykenco comturners of roboroughaurdervecruiserci comcorpbanknetcateralenabc auto parts chloorkopwww qbird orgapm4rentanne aummerswww.railroadcatalog.comfgccu orgwww.brainfun.comwirral tennis leaguecybernetcom casbhonlibebolsover cruise club last minute dealseservices palomar collegebgf coospacewww mdiep