IP Address: 74.6.50.150
Country: United States (US)
Page Speed: 50%
Domain Age: 21
Alexarank: #178471
Created Date: 06-11-1996
Updated Date: 04-10-2016
Expired Date: 04-11-2017
Meta Title: Yahoo - login

Server location


Geo IP provides you such as latitude, longitude and ISP (Internet Service Provider) etc. informations. Our GeoIP service has found where is host yahoomail.com . hosted in United States and accessing the internet through Yahoo! .

Latitude: 37.4249
Longitude: -122.0074
Timezone: America/Los_Angeles
Country: United States (US)
City: Sunnyvale
Region: California
Region Code: CA
Postal Code: 94089

DNS Records


DNS (Domain Name System) is a system that converts human-readable website names into computer-readable numeric IP addresses.

A record assigned to 74.6.50.150 for yahoomail.com

Host Type TTL Class Other
yahoomail.com. CAA 7199 IN 0 iodef "mailto:"
yahoomail.com. CAA 7199 IN 0 issue "symantec.com"
yahoomail.com. CAA 7199 IN 0 issue "digicert.com"
yahoomail.com. SOA 7199 IN hidden-master.yahoo.com. hostmaster.yahoo-inc.com. 201 900 604800 600
yahoomail.com. NS 21599 IN ns5.yahoo.com.
yahoomail.com. NS 21599 IN ns1.yahoo.com.
yahoomail.com. NS 21599 IN ns3.yahoo.com.
yahoomail.com. NS 21599 IN ns4.yahoo.com.
yahoomail.com. NS 21599 IN ns2.yahoo.com.
yahoomail.com. MX 7199 IN 0 .
yahoomail.com. A 7199 IN 74.6.50.150
yahoomail.com. A 7199 IN 77.238.184.150
yahoomail.com. A 7199 IN 106.10.212.150
yahoomail.com. A 7199 IN 98.137.236.150
yahoomail.com. A 7199 IN 124.108.105.150

Heading Analysis


Sign in
Upgrade your app!
Yahoo makes it easy to enjoy what matters most in your world.

Whois Information


In this section, you can reach when the website was registered, when it will be expire, what is contact details of the site with the following informations.

yahoomail.com has 21 years old. yahoomail.com registered by MarkMonitor, Inc.. yahoomail.com taken by Domain Administrator on 06/11/1996 and it will be expired on 04/11/2017

Registrar Name: MarkMonitor, Inc.
Registrar Organization: MarkMonitor, Inc.
Registrant Name: Domain Administrator
Registrant Organization: Yahoo! Inc.
Created Date: 06/11/1996
Updated Date: 04/10/2016
Expires Date: 04/11/2017
Admin Name: Domain Administrator
Admin Organization: Yahoo! Inc.
Technical Name: Domain Administrator
Technical Organization: Yahoo! Inc.

HTTP Header Analysis


HTTP Header information is a part of HTTP protocol that a user's browser sends to called ATS containing the details of what the browser wants and will accept back from the web server. Http Headers of Yahoomail.com

Status-Code: 200
Response Time: 407
X-Frame-Options DENY
X-Content-Type-Options nosniff
X-XSS-Protection 1; mode=block
x-powered-by Yahoo
Age 0
Pragma no-cache
Expires 0
Cache-Control nocache, no-store, must-revalidate
set-cookie AS=v=1&s=ZvG76NKD&d=A5a07e04b|toYIqtX.2cJ8jDXfVBGxHgaVDY87NEt2eMYxxoh3Df729ErHGG_.ZX8vqG.YP_iHi60n1DMsLZlvfnyXJIOMpOrJrmqA9D3NdTRSwCissSPI4bhQUlaKQMjadBKMNrWGYZMh7OncNnvRNa7vDxgqQlC5Nmt2xouLZzpMXl6tJT0ebz8wnWALgOTWuYXl7IC3px7zxA9eAHx.CIZXMmcQ78MlXmc5_CRlR6Yiuz9uFDgYdIn8WPGPEr7DN.ZB3wrNqDLN3eBj7bSERjMUvT7itzRvfG4oQQkNneZhcDUIGHOrgqvhUhE.dr_7xA0n_VapFSpK_Mb24vyC5atWx95TYTw_ij6YVoVBHt8kV51.V_mgkIVE8Z3ENaP3jYlanjLfeEP2O9RKAWIly4ZCHzhjTd46gB6JcIHEyZBA1r3ee9G.4m.7Qz3Z3qJaSVFPCH4qCL.jtPclwPmf_RgA29rDIaTLCaLtyFhsSN4xQG7BcFbzMWvLJ5HRRaO4WZp5.o3G0n63ykO8a018DRHQNnBZl6u1wywIXbWfCIGZ1BYiy7BASpQlUSfDfhli9XbAnQO1it4fIdiO2Kwm4hlM9WWxKu3GEgH0s_1U24xWOmy2DtK.EmlzCpnm30.SrZn2.qamBLJwPn_CpyE7kg0cutamEc7P9Tp0z57OFK4foiGNZkTYy0Hhn80O85g6IlNuZJQQNsxOggF4sx8E1w.17SJnxo.ujiI520Lr8AM6BtWHKXMFsFIPewwLtox.mqUFwh4jkg_f7Ic2La7DXmAgE6WQ_C1ZHyzeaJN_niZvMKhYyGR09aNdQw45HaxAMYag7sDb~A; path=/; domain=login.yahoo.com; secure; HttpOnly
Content-Type text/html; charset=utf-8
Content-Security-Policy-Report-Only child-src 'self' / / / / / 'self' / / / / 'self' / / / / / / / / 'self' data: / / / / / / / / / / / / / / / / / / / / / / / 'self' 'unsafe-eval' / / / / / / / / / 'nonce-ztSGt/j1dlwbHeH/o/vyTQpFMI3SRcEuhQi6ZO8dduf5o1/N' ;style-src * 'unsafe-inline'
Vary Accept-Encoding
Content-Encoding gzip
Date Sat, 11 Nov 2017 05:46:51 GMT
Transfer-Encoding chunked
Connection close
Strict-Transport-Security max-age=15552000
Server ATS
Go to top

Reverse Ip

Websites hosted with same IP Address

Favicon of yahoolmail.com yahoolmail.com Yahoo!
Favicon of emailyahoo.eu emailyahoo.eu Yahoo!
Favicon of yahoonews.com yahoonews.com Yahoo News - Latest News & Headlines
Favicon of y2o.de y2o.de Yahoo!
Favicon of xn--yhoo-loa.de xn--yhoo-loa.de
Favicon of ya-hoo.de ya-hoo.de Yahoo!
Favicon of sex-yahoo.de sex-yahoo.de
Favicon of sexyahoo.de sexyahoo.de
Favicon of seeitnow.net seeitnow.net Yahoo!
Favicon of audionet.net audionet.net Yahoo!
More >>

Reverse Whois

Websites registered with same Owner.

Favicon of yahoo.net yahoo.net Yahoo
Favicon of flicker.com flicker.com Find your inspiration. | Flickr
Favicon of yahhoomail.com yahhoomail.com Yahoo - login
Favicon of yahoolmail.com yahoolmail.com Yahoo!
Favicon of ymail.com ymail.com Yahoo - login
Favicon of yahoo-mail.com yahoo-mail.com Yahoo!
Favicon of yahoonews.com yahoonews.com Yahoo News - Latest News & Headlines
Favicon of yahoofinance.com yahoofinance.com Yahoo Finance - Business Finance, Stock Market, Quotes, News
Favicon of yahoo.com yahoo.com Yahoo
Favicon of flickr.com flickr.com Find your inspiration. | Flickr
More >>

Similars

Favicon of yahoomail.de yahoomail.de Yahoo!
Favicon of yahoomail.om yahoomail.om
Favicon of yahoomail.com.ph yahoomail.com.ph
Favicon of yahoomail.in yahoomail.in Yahoo!
Favicon of yahoomail.org yahoomail.org Yahoo!
Favicon of yahoomail.marketing yahoomail.marketing
Favicon of yahoomail.yahoo yahoomail.yahoo
Favicon of yahoomail.it yahoomail.it
Favicon of yahoomail.hu yahoomail.hu
Favicon of yahoomail.co yahoomail.co Yahoomail.co
More >>
More Less
More Less
More Less

Related pages


domicile.punjab.gov.pk4netjobsyilo gummy bearslauhoff credit unionwww.peoplesbankga.comezpassntv24uaoptonline.neytwww.southsudantribune.comwestwardho org auyornhub compowerschool slohsprezi co0mibm7 hindi newswww.firesidenaturalgas.comwww.thegreatamericanlogco.comalktera bluepapajohmsstarbuck.scomuni-pr.ekonomikxplosimnydancestorekeglers pain relieffriv.xcowww ldrtaxamnesty comlake beulah yacht clubautm career centerfirstfd com online bankingspynwesefinancialcaryande xruleominster employees fcuprincetonk12.orgwww scctax orgaccuradaryornhub comnatutoget.comflvtomp3converteravana highland ridge reviewsbhcso orgbayridge apartments nashua nhthehangover compapajohms93.5 whmi school closingspassportlondon dfa ieargooascsc skillportketamibidhaa kiswahili radio tehranrivendale retreat kangaroo valleyseven bluff cabins concan txuanw federal credit unionwww bingoblitz comsportskizurnal.rswww 45tvhn comwww cnbmn comdmv.eduwww.waimart.comwww hsalaredo orggravacarssportskizurnal.rszeborafshakura pigmentation beauty reviewwww.aaautobay.co.zawww.toysruscareers.comwww.barnabashealthcareers.organarzonplaystationneteorkwww capitalareahelpwantedvacuear reviewsallstrong restaurant equipmentyouut5begreendale cinema comnutracleanse.bizmyokanagan.bc.cayeshivanet newsspohnfcu